PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G117800.1
Common NameB456_012G117800, LOC105781002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 352aa    MW: 39754 Da    PI: 8.0512
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G117800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.9e-3268121255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH rFv+ave+LGG+++AtPk +l++m++kgL+++hvkSHLQ+YR+
  Gorai.012G117800.1  68 PRLRWTPDLHLRFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQMYRS 121
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.72964124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-3064122IPR009057Homeodomain-like
SuperFamilySSF466894.3E-1566122IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-2368123IPR006447Myb domain, plants
PfamPF002495.7E-1069120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MERNSSTECS KTAPSEQSDH QVEAEADSES EENDGESMPR NGGSSSNSTV EENDKKPSVR  60
PYVRSKMPRL RWTPDLHLRF VHAVERLGGQ DRATPKLVLQ MMNIKGLSIA HVKSHLQMYR  120
SKKIDDPRQV ISDHRHLVQS GDGNIFSLNQ LPMLQGYNHH HQGDSSNTFR YRDTSWNGRH  180
FSMRNPYTSR SFTDKQIPVL HGTVTDKIFG SNWTNYNFRM DTSSFNTLLP SWKCHEVLKN  240
EISSSSPNLQ SFLTKPSAQA KVEDETNCSR NSAQERRAMK RTISDSNLDL DLTLRLTQAK  300
EEKRPSSEED DVGLSLSLCG PPSSSKLSRL KGEDDSSREN GRRVSTLDLT I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461015.10.0PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
TrEMBLA0A0D2V4G20.0A0A0D2V4G2_G
STRINGPOPTR_0016s12940.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-69G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]